PDB entry 2dn6

View 2dn6 on RCSB PDB site
Description: Solution structure of the PH domain of KIAA0640 protein from human
Class: signaling protein
Keywords: PH domain, KIAA0640 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0640 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0640
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UH65 (7-108)
      • cloning artifact (0-6)
      • cloning artifact (109-114)
    Domains in SCOPe 2.04: d2dn6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dn6A (A:)
    gssgssgvlkqgymmkkghrrknwterwfvlkpniisyyvsedlkdkkgdilldenccve
    slpdkdgkkclflvkcfdktfeisasdkkkkqewiqaihstihllklgssgpssg