PDB entry 2dn0

View 2dn0 on RCSB PDB site
Description: Solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
Class: transcription
Keywords: Triple homeobox 1 protein, KIAA0395, TIX1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc fingers and homeoboxes protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ZHX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4I2 (7-69)
      • cloning artifact (0-6)
      • cloning artifact (70-75)
    Domains in SCOPe 2.06: d2dn0a1, d2dn0a2, d2dn0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dn0A (A:)
    gssgssgasiyknkksheqlsalkgsfcrnqfpgqsevehltkvtglstrevrkwfsdrr
    yhcrnlkgsrsgpssg