PDB entry 2dmu

View 2dmu on RCSB PDB site
Description: Solution structure of the homeobox domain of Homeobox protein goosecoid
Class: DNA binding protein
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeobox protein goosecoid
  Species: Homo sapiens [TaxId:9606]
  Gene: GSC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56915 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.07: d2dmua1, d2dmua2, d2dmua3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmuA (A:)
  gssgssgrrhrtiftdeqlealenlfqetkypdvgtreqlarkvhlreekvevwfknrra
  kwrrsgpssg