PDB entry 2dmq

View 2dmq on RCSB PDB site
Description: Solution structure of the homeobox domain of LIM/homeobox protein Lhx9
Class: DNA binding protein
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LIM/homeobox protein Lhx9
  Species: Homo sapiens [TaxId:9606]
  Gene: LHX9
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NQ69 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.04: d2dmqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmqA (A:)
  gssgssgkrmrtsfkhhqlrtmksyfainhnpdakdlkqlaqktgltkrvlqvwfqnara
  kfrrnllrqenggvsgpssg