PDB entry 2dm4

View 2dm4 on RCSB PDB site
Description: Solution structure of the second fn3 domain of human sorLA/LR11
Class: lipid transport
Keywords: beta-sandwich, Sorting protein-related receptor containing LDLR class A repeats, SorLA, Low-density lipoprotein receptor relative with 11 ligand-binding repeats, LR11, Alzheimer's disease, APP, BACE1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIPID TRANSPORT
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sortilin-related receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: SORL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92673 (7-101)
    • cloning artifact (0-6)
    • cloning artifact (102-107)
  Domains in SCOPe 2.05: d2dm4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dm4A (A:)
  gssgssgpdaprnlqlslpreaegvivghwappihthglireyiveysrsgskmwasqra
  asnfteiknllvntlytvrvaavtsrgignwsdsksittikgsgpssg