PDB entry 2dm1

View 2dm1 on RCSB PDB site
Description: Solution structure of the second SH3 domain of human protein vav-2
Class: signaling protein
Keywords: Rho family Guanine nucleotide exchange factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-20, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein vav-2
    Species: Homo sapiens [TaxId:9606]
    Gene: VAV2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52735 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOPe 2.08: d2dm1a1, d2dm1a2, d2dm1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dm1A (A:)
    gssgssggtavarynfaardmrelslregdvvriysriggdqgwwkgetngrigwfpsty
    veeegiqsgpssg