PDB entry 2dm0

View 2dm0 on RCSB PDB site
Description: Solution structure of the SH2 domain of human Tyrosine-protein kinase TXK
Class: transferase
Keywords: TEC family kinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase TXK
  Species: Homo sapiens [TaxId:9606]
  Gene: TXK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42681 (7-118)
    • cloning artifact (0-6)
    • cloning artifact (119-124)
  Domains in SCOPe 2.08: d2dm0a1, d2dm0a2, d2dm0a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dm0A (A:)
  gssgssgnkitnleiyewyhrnitrnqaehllrqeskegafivrdsrhlgsytisvfmga
  rrsteaaikhyqikkndsgqwyvaerhafqsipeliwyhqhnaaglmtrlrypvglmgss
  gpssg