PDB entry 2dlx

View 2dlx on RCSB PDB site
Description: Solution structure of the UAS domain of human UBX domain-containing protein 7
Class: structural genomics, unknown function
Keywords: UAS domain, UBX domain-containing protein 7, Protein KIAA0794, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXD7, KIAA0794
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (7-146)
      • cloning artifact (0-6)
      • cloning artifact (147-152)
    Domains in SCOPe 2.06: d2dlxa1, d2dlxa2, d2dlxa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlxA (A:)
    gssgssgidkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqcl
    nrdvwsneavkniirehfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewh
    qldvssfldqvtgflgehgqldglssssgpssg