PDB entry 2dlw

View 2dlw on RCSB PDB site
Description: Solution structure of the IRS domain of human docking protein 2, isoform a
Class: signaling protein
Keywords: IRS domain, Docking protein 2, isoform a, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Docking protein 2, isoform a
  Species: Homo sapiens [TaxId:9606]
  Gene: DOK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8N5A4 (7-106)
    • cloning artifact (0-6)
    • cloning artifact (107-112)
  Domains in SCOPe 2.04: d2dlwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dlwA (A:)
  gssgssghkefavtmrpteaserchlrgsytlragesalelwggpepgtqlydwpyrflr
  rfgrdkvtfsfeagrrcvsgegnfefetrqgneiflaleeaisaqknsgpssg