PDB entry 2dlt

View 2dlt on RCSB PDB site
Description: Solution structure of the Ig-like domain(433- 525) of murine myosin-binding protein C, fast-type
Class: contractile protein
Keywords: Ig-like domain, myosin binding protein C,fast-type, Mybpc2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin binding protein C, fast-type
    Species: Mus musculus [TaxId:10090]
    Gene: Mybpc2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XKE0 (7-99)
      • cloning artifact (0-6)
      • cloning artifact (100-105)
    Domains in SCOPe 2.06: d2dlta1, d2dlta2, d2dlta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dltA (A:)
    gssgssgqlevlqdiadltvkaaeqavfkcevsdekvtgkwykngvevrpskritishvg
    rfhklviddvrpedegdytfvpdgyalslsaklnfleikvsgpssg