PDB entry 2dlr

View 2dlr on RCSB PDB site
Description: Solution structure of the RGS domain of human Regulator of G-protein signaling 10
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signaling 10, RGS10, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 10
  Species: Homo sapiens [TaxId:9606]
  Gene: RGS10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43665 (7-142)
    • cloning artifact (0-6)
    • cloning artifact (143-148)
  Domains in SCOPe 2.08: d2dlra1, d2dlra2, d2dlra3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dlrA (A:)
  gssgssgslkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdk
  tqmqekakeiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsy
  srflksdlflkhkrteeeeedlpsgpssg