PDB entry 2dlh

View 2dlh on RCSB PDB site
Description: Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
Class: hydrolase
Keywords: Protein-tyrosine phosphatase delta, R-PTP-delta, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2006-04-18, released 2006-10-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Receptor-type tyrosine-protein phosphatase delta
  Species: Homo sapiens [TaxId:9606]
  Gene: PTPRD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23468 (7-114)
    • cloning artifact (0-6)
    • cloning artifact (115-120)
  Domains in SCOPe 2.04: d2dlha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dlhA (A:)
  gssgssgpvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdp
  tqhvnnwmkhnvadsqittignlvpqktysvkvlaftsigdgplssdiqvitqtgsgpss
  g