PDB entry 2dlf

View 2dlf on RCSB PDB site
Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75
Class: immune system
Keywords: fv fragment, immunoglobulin, immune system
Deposited on 1998-12-17, released 1999-12-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.184
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (anti-dansyl immunoglobulin igg2a(s) (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01801 (0-End)
      • conflict (23)
      • conflict (48)
      • conflict (51)
      • conflict (78-79)
      • conflict (84)
      • conflict (99)
      • conflict (101-103)
      • insertion (104)
      • conflict (105)
    Domains in SCOPe 2.04: d2dlfh_
  • Chain 'L':
    Compound: protein (anti-dansyl immunoglobulin igg2a(s)-kappa (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01631 (0-112)
      • conflict (16)
      • conflict (100)
      • conflict (104)
    Domains in SCOPe 2.04: d2dlfl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    aepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlfL (L:)
    dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr