PDB entry 2dlf

View 2dlf on RCSB PDB site
Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75
Deposited on 1998-12-17, released 1999-12-17
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-17, with a file datestamp of 1999-12-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.184
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d2dlfh_
  • Chain 'L':
    Domains in SCOP 1.55: d2dlfl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlfL (L:)
    dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr