PDB entry 2dl4

View 2dl4 on RCSB PDB site
Description: Solution structure of the first SH3 domain of Stac protein
Class: signaling protein
Keywords: SH3 domain, Stac protein, SRC homology 3, cysteine-rich domain protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-17, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Stac
    Species: Homo sapiens [TaxId:9606]
    Gene: STAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99469 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.06: d2dl4a1, d2dl4a2, d2dl4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dl4A (A:)
gssgssgntyvalykfvpqenedlemrpgdiitlledsnedwwkgkiqdrigffpanfvq
rlsgpssg