PDB entry 2dl3

View 2dl3 on RCSB PDB site
Description: Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1
Class: cell adhesion, signaling protein
Keywords: SH3 domain, Sorbin and SH3 domain-containing protein 1, Ponsin, c-Cbl-associated protein, CAP, SH3 domain protein 5, SH3P12, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION, SIGNALING PROTEIN
Deposited on 2006-04-17, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sorbin and SH3 domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SORBS1, KIAA1296, SH3D5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BX66 (7-61)
    • cloning artifact (0-6)
    • cloning artifact (62-67)
  Domains in SCOPe 2.06: d2dl3a1, d2dl3a2, d2dl3a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dl3A (A:)
  gssgssgrparakfdfkaqtlkelplqkgdivyiykqidqnwyegehhgrvgifprtyie
  llsgpssg