PDB entry 2dl2

View 2dl2 on RCSB PDB site
Description:
Deposited on 1999-03-08, released 1999-03-30
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2dl2a1, d2dl2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dl2A (A:)
    ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
    fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlages
    vtlscssrssydmyhlsregeahecrfsagpkvngtfqadfplgpathggtyrcfgsfrd
    spyewsnssdpllvsvi