PDB entry 2dkw

View 2dkw on RCSB PDB site
Description: Solution structure of the bromodomain of human protein KIAA1240
Class: gene regulation
Keywords: bromodomain-like, FIVE-HELIX, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2006-04-14, released 2006-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein KIAA1240
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1240
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULI0 (7-124)
      • cloning artifact (0-6)
      • cloning artifact (125-130)
    Domains in SCOPe 2.08: d2dkwa1, d2dkwa2, d2dkwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dkwA (A:)
    gssgssgntlrelrlflrdvtkrlatdkrfnifskpvsdylevikepmdlstvitkidkh
    nyltakdflkdidlicsnaleynpdkdpgdkiirhractlkdtahaiiaaeldpefnklc
    eeikesgpssg