PDB entry 2dkq

View 2dkq on RCSB PDB site
Description: Solution structure of the PTB domain of KIAA1075 protein from human
Class: signaling protein
Keywords: PTB domain, KIAA1075 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-13, released 2006-10-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1075 protein
    Species: HOMO SAPIENS
    Gene: TENC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z5T9 (7-153)
      • cloning artifact (0-6)
      • cloning artifact (154-159)
    Domains in SCOP 1.73: d2dkqa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dkqA (A:)
    gssgssgmstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvh
    fkvsaqgitltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgs
    pwenvchlfaeldpdqpagaivtfitkvllgqrksgpssg