PDB entry 2dk9

View 2dk9 on RCSB PDB site
Description: Solution structure of Calponin Homology domain of Human MICAL-1
Class: signaling protein
Keywords: helix, SIGNALING PROTEIN
Deposited on 2006-04-07, released 2006-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nedd9-interacting protein with calponin homology and lim domains
    Species: Homo sapiens [TaxId:9606]
    Gene: MICAL1, MICAL, NICAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TDZ2 (9-117)
      • expression tag (0-8)
    Domains in SCOPe 2.05: d2dk9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dk9A (A:)
    mghhhhhhmgsagtqeellrwcqeqtagypgvhvsdlssswadglalcalvyrlqpglle
    pselqglgaleatawalkvaenelgitpvvsaqavvagsdplgliaylshfhsafksm