PDB entry 2dk5

View 2dk5 on RCSB PDB site
Description: Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
Class: translation, transferase
Keywords: NMR, structural genomics, Winged helix domain, DNA-directed RNA polymerase III, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-06, released 2006-10-06
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-directed RNA polymerase III 39 kDa polypeptide
  Species: HOMO SAPIENS
  Gene: POLR3F, RPC39
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H1D9 (7-84)
    • cloning artifact (0-6)
    • engineered (41)
    • cloning artifact (85-90)
  Domains in SCOP 1.75: d2dk5a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dk5A (A:)
  gssgssgdsqnagkmkgsdnqeklvyqiiedagnkgiwsrdvryksnlplteinkilknl
  eskklikavksvaaskkkvymlynlsgpssg