PDB entry 2dk2

View 2dk2 on RCSB PDB site
Description: Solution structure of RRM domain in heterogeneous nuclear ribonucleoprotein R (hnRNP R)
Class: gene regulation
Keywords: NMR, RRM domain, Heterogeneous nuclear ribonucleoprotein R, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2006-04-06, released 2006-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein R
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43390 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.04: d2dk2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dk2A (A:)
    gssgssgdpevmakvkvlfvrnlattvteeileksfsefgklervkklkdyafvhfedrg
    aavkamdemngkeiegeeieivlakppdkkrsgpssg