PDB entry 2dji

View 2dji on RCSB PDB site
Description: Crystal Structure of Pyruvate Oxidase from Aerococcus viridans containing FAD
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein
Deposited on 2006-04-03, released 2007-05-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DJI (0-589)
    Domains in SCOPe 2.04: d2djia1, d2djia2, d2djia3
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2djiA (A:)
    dnkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaav
    mqskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqn
    pmydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssan
    slrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgkn
    fetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidi
    dpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletke
    egdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaip
    gglgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedt
    nknlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqd
    rpipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik