PDB entry 2dj0

View 2dj0 on RCSB PDB site
Description: The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2
Class: structural genomics, unknown function
Keywords: AVLA237, CGI-31 protein, TXNDC14, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thioredoxin-related transmembrane protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: TXNDC14
  Database cross-references and differences (RAF-indexed):
  • GB AAH00666 (7-130)
    • cloning artifact (0-6)
    • cloning artifact (131-136)
  Domains in SCOPe 2.08: d2dj0a1, d2dj0a2, d2dj0a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dj0A (A:)
  gssgssgyikyfndktideelerdkrvtwiveffanwsndcqsfapiyadlslkynctgl
  nfgkvdvgrytdvstrykvstspltkqlptlilfqggkeamrrpqidkkgravswtfsee
  nvirefnlnelsgpssg