PDB entry 2div

View 2div on RCSB PDB site
Description: Solution structure of the RRM domain of TRNA selenocysteine associated protein
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, TRNA selenocysteine associated protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRNA selenocysteine associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SECP43; RP4-669K10.4; RP4-669K10.4-001
    Database cross-references and differences (RAF-indexed):
    • GB AAH00680 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOPe 2.07: d2diva1, d2diva2, d2diva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2divA (A:)
    gssgssgmaaslwmgdlepymdenfisrafatmgetvmsvkiirnrltgipagycfvefa
    dlataekclhkingkplpgatpakrfklnyatysgpssg