PDB entry 2dis

View 2dis on RCSB PDB site
Description: Solution structure of the RRM domain of unnamed protein product
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unnamed protein product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB BAA91049 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.06: d2disa1, d2disa2, d2disa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2disA (A:)
gssgssgncrlfiggipkmkkreeileeiakvtegvldvivyasaadkmknrgfafveye
shraaamarrklmpgriqlwghqiavdwaepeidvdedvmetvsgpssg