PDB entry 2dil

View 2dil on RCSB PDB site
Description: Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
Class: cell adhesion
Keywords: SH3 domain, PEST phosphatase-interacting protein 1, CD2-binding protein 1, Cell adhesion, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-30, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proline-serine-threonine phosphatase-interacting protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: PSTPIP1, CD2BP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43586 (7-62)
    • cloning artifact (0-6)
    • cloning artifact (63-68)
  Domains in SCOPe 2.08: d2dila1, d2dila2, d2dila3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dilA (A:)
  gssgssgaqeyralydytaqnpdeldlsagdilevilegedgwwtverngqrgfvpgsyl
  eklsgpssg