PDB entry 2die

View 2die on RCSB PDB site
Description: Alkaline alpha-amylase AmyK from Bacillus sp. KSM-1378
Class: hydrolase
Keywords: beta-alpha-barrels, hydrolase
Deposited on 2006-03-29, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-06, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2diea1, d2diea2
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dieA (A:)
    hhngtngtmmqyfewhlpndgnhwnrlrddaanlkskgitavwippawkgtsqndvgyga
    ydlydlgefnqkgtvrtkygtrsqlqgavtslknngiqvygdvvmnhkggadgtemvnav
    evnrsnrnqeisgeytieawtkfdfpgrgnthsnfkwrwyhfdgtdwdqsrqlqnkiykf
    rgtgkawdwevdiengnydylmyadidmdhpevinelrnwgvwytntlnldgfridavkh
    ikysytrdwlthvrnttgkpmfavaefwkndlaaienylnktswnhsvfdvplhynlyna
    snsggyfdmrnilngsvvqkhpihavtfvdnhdsqpgealesfvqswfkplayaliltre
    qgypsvfygdyygipthgvpsmkskidpllqarqtyaygtqhdyfdhhdiigwtregdss
    hpnsglatimsdgpggnkwmyvgkhkagqvwrditgnrsgtvtinadgwgnftvnggavs
    vwvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dieA (A:)
    tngtmmqyfewhlpndgnhwnrlrddaanlkskgitavwippawkgtsqndvgygaydly
    dlgefnqkgtvrtkygtrsqlqgavtslknngiqvygdvvmnhkggadgtemvnavevnr
    snrnqeisgeytieawtkfdfpgrgnthsnfkwrwyhfdgtdwdqsrqlqnkiykfrgtg
    kawdwevdiengnydylmyadidmdhpevinelrnwgvwytntlnldgfridavkhikys
    ytrdwlthvrnttgkpmfavaefwkndlaaienylnktswnhsvfdvplhynlynasnsg
    gyfdmrnilngsvvqkhpihavtfvdnhdsqpgealesfvqswfkplayaliltreqgyp
    svfygdyygipthgvpsmkskidpllqarqtyaygtqhdyfdhhdiigwtregdsshpns
    glatimsdgpggnkwmyvgkhkagqvwrditgnrsgtvtinadgwgnftvnggavsvwvk
    q