PDB entry 2dhz

View 2dhz on RCSB PDB site
Description: Solution Structure of the RA Domain in the Human Link Guanine Nucleotide Exchange Factor II (Link-GEFII)
Class: signaling protein
Keywords: link guanine nucleotide exchange factor II, Link-GEFII, RA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-03-27, released 2006-09-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rap guanine nucleotide exchange factor (GEF)-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Link-GEFII
    Database cross-references and differences (RAF-indexed):
    • GB NP_057423 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.05: d2dhza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhzA (A:)
    gssgssgdeifcrvympdhsyvtirsrlsasvqdilgsvteklqyseepagredslilva
    vsssgekvllqptedcvftalginshlfactrdsyealvplpeeiqvspgdteisgpssg