PDB entry 2dhg

View 2dhg on RCSB PDB site
Description: Solution structure of the C-terminal RNA recognition motif in tRNA selenocysteine associated protein
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-23, released 2006-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA selenocysteine associated protein (SECP43)
    Species: Homo sapiens [TaxId:9606]
    Gene: TRSPAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NX07 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.07: d2dhga1, d2dhga2, d2dhga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhgA (A:)
    gssgssgpeyslfvgdltpdvddgmlyeffvkvypscrggkvvldqtgvskgygfvkftd
    eleqkraltecqgavglgskpvrlsvaipkasrvkpvesgpssg