PDB entry 2dhb

View 2dhb on RCSB PDB site
Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution
Deposited on 1973-11-01, released 1977-06-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2dhba_
  • Chain 'B':
    Domains in SCOP 1.55: d2dhbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhbA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvadgltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhbB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlalvvarhfgk
    dftpelqasyqkvvagvanalahkyh