PDB entry 2dh8

View 2dh8 on RCSB PDB site
Description: Solution structure of the N-terminal RNA binding domain in DAZ-associated protein 1
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-23, released 2006-09-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DAZ-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAZAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EP5 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOPe 2.04: d2dh8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dh8A (A:)
gssgssgmnnsgadeigklfvggldwsttqetlrsyfsqygevvdcvimkdkttnqsrgf
gfvkfkdpncvgtvlasrphtldgrnidpkpctprgmqpsgpssg