PDB entry 2dgx

View 2dgx on RCSB PDB site
Description: Solution structure of the RNA recognition motif in KIAA0430 protein
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-16, released 2006-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0430 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0430
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4J9 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.05: d2dgxa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dgxA (A:)
gssgssgngadvqvsnidyrlsrkelqqllqeafarhgkvksvelsphtdyqlkavvqme
nlqdaigavnslhrykigskkilvslatgasgpssg