PDB entry 2dgo

View 2dgo on RCSB PDB site
Description: Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-15, released 2006-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic granule-associated RNA binding protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tia1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52912 (7-108)
      • cloning artifact (0-6)
      • cloning artifact (109-114)
    Domains in SCOPe 2.06: d2dgoa1, d2dgoa2, d2dgoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dgoA (A:)
gssgssgqkkdtsnhfhvfvgdlspeittedikaafapfgrisdarvvkdmatgkskgyg
fvsffnkwdaenaiqqmggqwlggrqirtnwatrkppapkstyesntkqsgpssg