PDB entry 2dg9

View 2dg9 on RCSB PDB site
Description: FK506-binding protein mutant WL59 complexed with Rapamycin
Class: isomerase
Keywords: immunophilin, isomerase, rotamase
Deposited on 2006-03-09, released 2006-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 1A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered (58)
  Domains in SCOPe 2.02: d2dg9a_
• Heterogens: RAP, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dg9A (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgle
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle