PDB entry 2dg3

View 2dg3 on RCSB PDB site
Description: Wildtype FK506-binding protein complexed with Rapamycin
Class: isomerase
Keywords: immunophilin, isomerase, rotamase
Deposited on 2006-03-08, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.218
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dg3a1
  • Heterogens: RAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dg3A (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle