PDB entry 2dfd

View 2dfd on RCSB PDB site
Description: Crystal Structure of Human Malate Dehydrogenase Type 2
Class: oxidoreductase
Keywords: Dehydrogenase, Citric acid cycle, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-02-28, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfda1, d2dfda2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfdb1, d2dfdb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfdc1, d2dfdc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfdd1, d2dfdd2
  • Heterogens: MLT, CL, NAD, HIS, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dfdA (A:)
    mhhhhhhssgvdlgtenlyfqsmsaqnnakvavlgasggigqplslllknsplvsrltly
    diahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfnt
    nativatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivr
    antfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagte
    vvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgk
    kgieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfdA (A:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dfdB (B:)
    mhhhhhhssgvdlgtenlyfqsmsaqnnakvavlgasggigqplslllknsplvsrltly
    diahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfnt
    nativatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivr
    antfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagte
    vvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgk
    kgieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfdB (B:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dfdC (C:)
    mhhhhhhssgvdlgtenlyfqsmsaqnnakvavlgasggigqplslllknsplvsrltly
    diahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfnt
    nativatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivr
    antfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagte
    vvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgk
    kgieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfdC (C:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dfdD (D:)
    mhhhhhhssgvdlgtenlyfqsmsaqnnakvavlgasggigqplslllknsplvsrltly
    diahtpgvaadlshietkaavkgylgpeqlpdclkgcdvvvipagvprkpgmtrddlfnt
    nativatltaacaqhcpeamicvianpvnstipitaevfkkhgvynpnkifgvttldivr
    antfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltgriqeagte
    vvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyfstplllgk
    kgieknlgigkvssfeekmisdaipelkasikkgedfvktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfdD (D:)
    nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
    eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
    vnstipitaevfkkhgvynpnkifgvttldivrantfvaelkgldparvnvpvigghagk
    tiiplisqctpkvdfpqdqltaltgriqeagtevvkakagagsatlsmayagarfvfslv
    damngkegvvecsfvksqetectyfstplllgkkgieknlgigkvssfeekmisdaipel
    kasikkgedfvktl