PDB entry 2df3

View 2df3 on RCSB PDB site
Description: The structure of Siglec-7 in complex with alpha(2,3)/alpha(2,6) disialyl lactotetraosyl 2-(trimethylsilyl)ethyl
Class: cell adhesion
Keywords: Siglec, sialic acid, ganglioside, Cell adhesion
Deposited on 2006-02-23, released 2006-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid-binding Ig-like lectin 7
    Species: Homo sapiens [TaxId:9606]
    Gene: SIGLEC7, AIRM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2df3a_
  • Heterogens: NAG, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2df3A (A:)
    gqksnrkdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkap
    vatnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykyd
    qlsvnvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2df3A (A:)
    kdysltmqssvtvqegmcvhvrcsfsypvtdsdpvhgywfraswkapvatnnpawavqee
    trdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt