PDB entry 2dep

View 2dep on RCSB PDB site
Description: Crystal Structure of xylanase B from Clostridium stercorarium F9
Class: hydrolase
Keywords: GLYCOSIDASE, XYLAN DEGRADATION, FAMILY 10, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, HYDROLASE
Deposited on 2006-02-16, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable celloxylanase
    Species: Clostridium stercorarium [TaxId:1510]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40942
      • see remark 999 (91-92)
      • see remark 999 (94)
    Domains in SCOPe 2.07: d2depa_
  • Chain 'B':
    Compound: Thermostable celloxylanase
    Species: Clostridium stercorarium [TaxId:1510]
    Gene: xynB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40942
      • see remark 999 (91-92)
      • see remark 999 (94)
    Domains in SCOPe 2.07: d2depb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2depA (A:)
    maedipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnf
    qwadadrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklll
    qrlenyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratrea
    ggsdiklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesi
    kkfaglgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsa
    vvfwgisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdpsrlrelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2depA (A:)
    dipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnfqwa
    dadrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklllqrl
    enyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratreaggs
    diklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesikkf
    aglgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsavvf
    wgisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2depB (B:)
    maedipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnf
    qwadadrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklll
    qrlenyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratrea
    ggsdiklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesi
    kkfaglgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsa
    vvfwgisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdpsrlrelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2depB (B:)
    ipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnfqwad
    adrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklllqrle
    nyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratreaggsd
    iklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesikkfa
    glgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsavvfw
    gisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdp