PDB entry 2dej

View 2dej on RCSB PDB site
Description: Crystal Structure of galaktokinase from Pyrococcus horikoshii with AMP-PN and galactose
Class: Transferase
Keywords: galactokinase, ADP analogue, galactose, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2006-02-10, released 2007-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable galactokinase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2deja1, d2deja2
  • Heterogens: GLA, APW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dejA (A:)
    mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
    lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
    nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpkdv
    silvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyiv
    renarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarl
    tgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dejA (A:)
    mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
    lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
    nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpkdv
    silvfytgvrsseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyivrena
    rvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarltgag
    fggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi