PDB entry 2dei

View 2dei on RCSB PDB site
Description: Crystal Structure of galaktokinase from Pyrococcus horikoshii with AMP-PNP and galactose
Class: Transferase
Keywords: galactokinase, ATP analogue, galactose, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2006-02-10, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable galactokinase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2deia1, d2deia2
  • Heterogens: GLA, MAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2deiA (A:)
    mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
    lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
    nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpkdv
    silvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyiv
    renarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarl
    tgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi