PDB entry 2ddy

View 2ddy on RCSB PDB site
Description: Solution Structure of Matrilysin (MMP-7) Complexed to Constraint Conformational Sulfonamide Inhibitor
Class: Hydrolase
Keywords: matrix metalloproteinase, matrilysin,complex, MMP-7, solution structure, madw01053, Hydrolase
Deposited on 2006-02-06, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrilysin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddya_
  • Heterogens: CA, ZN, MDW

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ddyA (A:)
    yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
    migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
    elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk