PDB entry 2ddq

View 2ddq on RCSB PDB site
Description: Crystal Structure of the Fab fragment of a R310 antibody complexed with (R)-HNE-histidine adduct
Class: immune system
Keywords: monoclonal antibody, 4-hydroxy-2-nonenal, immunoglobulin, IMMUNE SYSTEM
Deposited on 2006-02-02, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: R310 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddqh1
  • Chain 'L':
    Compound: R310 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DDQ (0-217)
    Domains in SCOPe 2.07: d2ddql1, d2ddql2
  • Heterogens: EPE, HRB, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ddqH (H:)
    kvklqesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycapyggywgqgttvtvssakttaps
    vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddqH (H:)
    kvklqesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycapyggywgqgttvtvssakttaps
    vyplapvcgtgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ddqL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne