PDB entry 2ddb

View 2ddb on RCSB PDB site
Description: Crystal structure of pseudecin from Pseudechis porphyriacus
Class: toxin
Keywords: CRISP, snake venom, CNG channel, TOXIN
Deposited on 2006-01-25, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddba1, d2ddba2
  • Chain 'B':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddbb1, d2ddbb2
  • Chain 'C':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddbc1, d2ddbc2
  • Chain 'D':
    Compound: Pseudecin
    Species: Pseudechis porphyriacus [TaxId:8671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddbd1, d2ddbd2
  • Heterogens: NA, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddbA (A:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddbA (A:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ddbB (B:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddbB (B:)
    kknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgk
    lrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligca
    sakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsnc
    kslakkskcqtewikkkcpascfchnkii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ddbC (C:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddbC (C:)
    nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
    cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
    kcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsncks
    lakkskcqtewikkkcpascfchnkii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ddbD (D:)
    nkknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvg
    klrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligc
    asakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsn
    ckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddbD (D:)
    kknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgk
    lrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligca
    sakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnrlctnpcnynndfsnc
    kslakkskcqtewikkkcpascfchnkii