PDB entry 2dd8

View 2dd8 on RCSB PDB site
Description: Crystal Structure of SARS-CoV Spike Receptor-Binding Domain Complexed with Neutralizing Antibody
Class: immune system/viral protein
Keywords: SARS, S protein, antibody, epitopes, vaccines, inhibitors, IMMUNE SYSTEM-VIRAL PROTEIN COMPLEX
Deposited on 2006-01-24, released 2006-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IGG Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: recombinant antibody Fab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dd8h1, d2dd8h2
  • Chain 'L':
    Compound: IGG Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: recombinant antibody Fab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dd8l1, d2dd8l2
  • Chain 'S':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: Tor2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dd8s1
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dd8H (H:)
    qvqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgiany
    aqkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssas
    tkgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktsplfvhhhhhhgdykd
    dddkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd8H (H:)
    vqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianya
    qkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssast
    kgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2dd8L (L:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd8L (L:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2dd8S (S:)
    pnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnd
    lcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgny
    nykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrv
    vvlsfellnapatvcgpklstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd8S (S:)
    nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs
    nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky
    rylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvls
    fellnapatvcg