PDB entry 2dct

View 2dct on RCSB PDB site
Description: Crystal structure of the TT1209 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-01-12, released 2006-01-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.199
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0104
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_143370 (0-104)
    Domains in SCOPe 2.05: d2dcta1
  • Chain 'B':
    Compound: hypothetical protein TTHA0104
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_143370 (0-104)
    Domains in SCOPe 2.05: d2dctb_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dctA (A:)
    meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
    vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dctB (B:)
    meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
    vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp