PDB entry 2dcr

View 2dcr on RCSB PDB site
Description: Fully automated solution structure determination of the Fes SH2 domain
Class: transferase
Keywords: SH2 domain, Fes, feline sarcoma oncogene, fully automated structure determination, FLYA algorithm, TRANSFERASE
Deposited on 2006-01-12, released 2006-10-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Fes/Fps
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07332 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.05: d2dcra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dcrA (A:)
    gssgssgevqkplheqlwyhgaipraevaellvhsgdflvresqgkqeyvlsvlwdglpr
    hfiiqsldnlyrlegegfpsipllidhllstqqpltkksgvvlhravpsgpssg