PDB entry 2dbv

View 2dbv on RCSB PDB site
Description:
Deposited on 1996-12-19, released 1997-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2dbvo1, d2dbvo2
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2dbvp1, d2dbvp2
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2dbvq1, d2dbvq2
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2dbvr1, d2dbvr2

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbvO (O:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbvP (P:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbvQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbvR (R:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl