PDB entry 2dbl

View 2dbl on RCSB PDB site
Description:
Deposited on 1994-02-08, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d2dblh1, d2dblh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d2dbll1, d2dbll2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dblH (H:)
    qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
    vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dblL (L:)
    dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr