PDB entry 2db8

View 2db8 on RCSB PDB site
Description: Solution structures of the fn3 domain of human Tripartite motif protein 9
Class: protein binding
Keywords: RING finger protein 91, TRIM9, KIAA0282, RNF91, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-12-15, released 2006-06-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif protein 9, isoform 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C026 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.04: d2db8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2db8A (A:)
    gssgssgpvpatpilqleeccthnnsatlswkqpplstvpadgyilelddgnggqfrevy
    vgketmctvdglhfnstynarvkafnktgvspysktlvlqtsegsgpssg